SCOP 1.55: Domain d1bfx__: 1bfx -

Lineage for d1bfx__ (1bfx -)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.120: Cytochrome b5 [55855] (1 superfamily)

4. Superfamily d.120.1: Cytochrome b5 [55856] (1 family)

5. Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)

6. Protein Cytochrome b5 [55858] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [55860] (12 PDB entries)

8. Domain d1bfx__: 1bfx - [41078]

Details for d1bfx__

PDB Entry: 1bfx

PDB Description: the solution nmr structure of the b form of oxidized rat microsomal cytochrome b5, minimized average structure

SCOP Domain Sequences for d1bfx__:

Sequence; same for both SEQRES and ATOM records:

>d1bfx__ d.120.1.1 (-) Cytochrome b5 {Rat (Rattus norvegicus)}
dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
vghstdarelsktyiigelhpddrskiakpsetl

Timeline for d1bfx__:

• d1bfx__ appears in SCOP 1.57
  
• d1bfx__ appears in the current release, SCOPe 2.08, called d1bfxa_