Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.120: Cytochrome b5 [55855] (1 superfamily) |
Superfamily d.120.1: Cytochrome b5 [55856] (1 family) |
Family d.120.1.1: Cytochrome b5 [55857] (4 proteins) |
Protein Cytochrome b5 [55858] (3 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [55860] (12 PDB entries) |
Domain d1bfx__: 1bfx - [41078] |
PDB Entry: 1bfx (more details)
SCOP Domain Sequences for d1bfx__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfx__ d.120.1.1 (-) Cytochrome b5 {Rat (Rattus norvegicus)} dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed vghstdarelsktyiigelhpddrskiakpsetl
Timeline for d1bfx__: