Lineage for d1bfxa_ (1bfx A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973074Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 2973075Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 2973076Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. 2973077Protein Cytochrome b5 [55858] (4 species)
  7. 2973099Species Norway rat (Rattus norvegicus) [TaxId:10116] [55860] (20 PDB entries)
  8. 2973120Domain d1bfxa_: 1bfx A: [41078]
    complexed with hem

Details for d1bfxa_

PDB Entry: 1bfx (more details)

PDB Description: the solution nmr structure of the b form of oxidized rat microsomal cytochrome b5, minimized average structure
PDB Compounds: (A:) cytochrome b5

SCOPe Domain Sequences for d1bfxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfxa_ d.120.1.1 (A:) Cytochrome b5 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
vghstdarelsktyiigelhpddrskiakpsetl

SCOPe Domain Coordinates for d1bfxa_:

Click to download the PDB-style file with coordinates for d1bfxa_.
(The format of our PDB-style files is described here.)

Timeline for d1bfxa_: