Lineage for d5yn6a_ (5yn6 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. Family c.66.1.25: mRNA cap methylase [88785] (4 proteins)
  6. Protein automated matches [190302] (11 species)
    not a true protein
  7. Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [419989] (12 PDB entries)
  8. Domain d5yn6a_: 5yn6 A: [410737]
    Other proteins in same PDB: d5yn6b_
    automated match to d2xyqa_
    complexed with sam, zn

Details for d5yn6a_

PDB Entry: 5yn6 (more details), 1.95 Å

PDB Description: crystal structure of mers-cov nsp10/nsp16 complex bound to sam
PDB Compounds: (A:) nsp16 protein

SCOPe Domain Sequences for d5yn6a_:

Sequence, based on SEQRES records: (download)

>d5yn6a_ c.66.1.25 (A:) automated matches {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
asadwkpghampslfkvqnvnlercelanykqsipmprgvhmniakymqlcqylntctla
vpanmrvihfgagsdkgiapgtsvlrqwlptdaiiidndlnefvsdaditlfgdcvtvrv
gqqvdlvisdmydpttknvtgsneskalfftylcnlinnnlalggsvaikitehswsvel
yelmgkfawwtvfctnanasssegfllginylgtikenidggamhanyifwrnstpmnls
tyslfdlskfqlklkgtpvlqlkesqinelvisllsqgkllirdndtlsvstd

Sequence, based on observed residues (ATOM records): (download)

>d5yn6a_ c.66.1.25 (A:) automated matches {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
asadwkpghampslfkvqnvnlercelanypmprgvhmniakymqlcqylntctlavpan
mrvihfgagsdkgiapgtsvlrqwlptdaiiidndlnefvsdaditlfgdcvtvrvgqqv
dlvisdmydptsneskalfftylcnlinnnlalggsvaikitehswsvelyelmgkfaww
tvfctnanasssegfllginylgtikenidggamhanyifwrnstpmnlstyslfdlskf
qlklkgtpvlqlkesqinelvisllsqgkllirdndtlsvstd

SCOPe Domain Coordinates for d5yn6a_ are not available.

Timeline for d5yn6a_:

  • d5yn6a_ is new in SCOPe 2.08-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d5yn6b_