Lineage for d1awpb_ (1awp B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35484Fold d.120: Cytochrome b5 [55855] (1 superfamily)
  4. 35485Superfamily d.120.1: Cytochrome b5 [55856] (1 family) (S)
  5. 35486Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)
  6. 35487Protein Cytochrome b5 [55858] (3 species)
  7. 35497Species Rat (Rattus norvegicus) [TaxId:10116] [55860] (12 PDB entries)
  8. 35499Domain d1awpb_: 1awp B: [41072]

Details for d1awpb_

PDB Entry: 1awp (more details), 2 Å

PDB Description: rat outer mitochondrial membrane cytochrome b5

SCOP Domain Sequences for d1awpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awpb_ d.120.1.1 (B:) Cytochrome b5 {Rat (Rattus norvegicus)}
dpavtyyrleevakrntaeetwmvihgrvyditrflsehpggeellleqagadatesfed
lghspdaremlkqyyigdvhpndlkp

SCOP Domain Coordinates for d1awpb_:

Click to download the PDB-style file with coordinates for d1awpb_.
(The format of our PDB-style files is described here.)

Timeline for d1awpb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1awpa_