Lineage for d1awpb_ (1awp B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973074Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 2973075Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 2973076Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. 2973077Protein Cytochrome b5 [55858] (4 species)
  7. 2973099Species Norway rat (Rattus norvegicus) [TaxId:10116] [55860] (20 PDB entries)
  8. 2973109Domain d1awpb_: 1awp B: [41072]
    complexed with hem

Details for d1awpb_

PDB Entry: 1awp (more details), 2 Å

PDB Description: rat outer mitochondrial membrane cytochrome b5
PDB Compounds: (B:) cytochrome b5

SCOPe Domain Sequences for d1awpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awpb_ d.120.1.1 (B:) Cytochrome b5 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dpavtyyrleevakrntaeetwmvihgrvyditrflsehpggeellleqagadatesfed
lghspdaremlkqyyigdvhpndlkp

SCOPe Domain Coordinates for d1awpb_:

Click to download the PDB-style file with coordinates for d1awpb_.
(The format of our PDB-style files is described here.)

Timeline for d1awpb_: