Lineage for d1awpa_ (1awp A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. Protein Cytochrome b5 [55858] (4 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [55860] (20 PDB entries)
  8. Domain d1awpa_: 1awp A: [41071]
    complexed with hem

Details for d1awpa_

PDB Entry: 1awp (more details), 2 Å

PDB Description: rat outer mitochondrial membrane cytochrome b5
PDB Compounds: (A:) cytochrome b5

SCOPe Domain Sequences for d1awpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awpa_ d.120.1.1 (A:) Cytochrome b5 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dpavtyyrleevakrntaeetwmvihgrvyditrflsehpggeellleqagadatesfed
lghspdaremlkqyyigdvhpndlkp

SCOPe Domain Coordinates for d1awpa_ are not available.

Timeline for d1awpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1awpb_