Lineage for d5xezc_ (5xez C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743308Domain d5xezc_: 5xez C: [410705]
    Other proteins in same PDB: d5xezd1, d5xezd2, d5xezl1, d5xezl2
    automated match to d6shgh_
    complexed with 97v, nag

Details for d5xezc_

PDB Entry: 5xez (more details), 3 Å

PDB Description: structure of the full-length glucagon class b g protein-coupled receptor
PDB Compounds: (C:) Antibody, mAb1, heavy chain

SCOPe Domain Sequences for d5xezc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xezc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvesgggvvqpgrslrlscaasgftfssygmhwvrqapgkglewvavmyydgsnkdy
vdsvkgrftisrdnskntlylqmnrlraedtavyycarekdhydiltgynyyygldvwgq
gttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvht
fpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d5xezc_:

Click to download the PDB-style file with coordinates for d5xezc_.
(The format of our PDB-style files is described here.)

Timeline for d5xezc_:

  • d5xezc_ is new in SCOPe 2.08-stable