Lineage for d1f04a_ (1f04 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83540Fold d.120: Cytochrome b5 [55855] (1 superfamily)
  4. 83541Superfamily d.120.1: Cytochrome b5 [55856] (1 family) (S)
  5. 83542Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)
  6. 83543Protein Cytochrome b5 [55858] (3 species)
  7. 83544Species Cow (Bos taurus) [TaxId:9913] [55859] (7 PDB entries)
  8. 83550Domain d1f04a_: 1f04 A: [41069]

Details for d1f04a_

PDB Entry: 1f04 (more details)

PDB Description: solution structure of oxidized bovine microsomal cytochrome b5 mutant (e44a, e48a, e56a, d60a) and its interaction with cytochrome c

SCOP Domain Sequences for d1f04a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f04a_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus)}
avkyytleeiqkhnnskstwlilhykvydltkfleehpggeavlraqaggdatanfeavg
hstdarelsktfiigelhpddr

SCOP Domain Coordinates for d1f04a_:

Click to download the PDB-style file with coordinates for d1f04a_.
(The format of our PDB-style files is described here.)

Timeline for d1f04a_: