Lineage for d1f04a_ (1f04 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. Protein Cytochrome b5 [55858] (4 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [55859] (18 PDB entries)
    Uniprot P00171 7-88 ! Uniprot P00171 8-89
  8. Domain d1f04a_: 1f04 A: [41069]
    complexed with hem; mutant

Details for d1f04a_

PDB Entry: 1f04 (more details)

PDB Description: solution structure of oxidized bovine microsomal cytochrome b5 mutant (e44a, e48a, e56a, d60a) and its interaction with cytochrome c
PDB Compounds: (A:) cytochrome b5

SCOPe Domain Sequences for d1f04a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f04a_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]}
avkyytleeiqkhnnskstwlilhykvydltkfleehpggeavlraqaggdatanfeavg
hstdarelsktfiigelhpddr

SCOPe Domain Coordinates for d1f04a_ are not available.

Timeline for d1f04a_: