Lineage for d5x0ta_ (5x0t A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745069Domain d5x0ta_: 5x0t A: [410682]
    Other proteins in same PDB: d5x0tb2, d5x0td2
    automated match to d6shgh_

Details for d5x0ta_

PDB Entry: 5x0t (more details), 2.5 Å

PDB Description: crystal structure of cd147 c2 domain in complex with fab of its monoclonal antibody 6h8
PDB Compounds: (A:) 6H8 Fab fragment heavy chain

SCOPe Domain Sequences for d5x0ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x0ta_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vkleesggglvqpggsmklscvasgftfsnfwmnwvrqspekglewvaeirlksnnyath
yaesvkgrftisrddskssvylqmnnlrtedtgiyyctsydyeywgqgtlvtvsaakttp
psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d5x0ta_:

Click to download the PDB-style file with coordinates for d5x0ta_.
(The format of our PDB-style files is described here.)

Timeline for d5x0ta_:

  • d5x0ta_ is new in SCOPe 2.08-stable