Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d5w08q_: 5w08 Q: [410641] Other proteins in same PDB: d5w08a_, d5w08b_, d5w08c_, d5w08d_, d5w08e_, d5w08f_, d5w08h2, d5w08j2, d5w08l2, d5w08n2, d5w08p2, d5w08r2 automated match to d6shgh_ complexed with gol, nag |
PDB Entry: 5w08 (more details), 2.6 Å
SCOPe Domain Sequences for d5w08q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w08q_ b.1.1.0 (Q:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvqsgaevkkpgasvkvscktsgytftayylhwvrqapgqgfewmawinpntgdtny aqkfqgrvtlsrdtsittaymeltrlrsddtavyycakdltlmyvfdsgwargahdyygm dvwgqgttvavsgastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgalt sgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepks
Timeline for d5w08q_: