Lineage for d1arol_ (1aro L:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972806Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2972807Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2972808Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 2972829Protein Bacteriophage T7 lysozyme (Zn amidase) [55848] (1 species)
  7. 2972830Species Bacteriophage T7 [TaxId:10760] [55849] (2 PDB entries)
  8. 2972832Domain d1arol_: 1aro L: [41063]
    Other proteins in same PDB: d1arop_
    protein/DNA complex; protein/RNA complex; complexed with hg

Details for d1arol_

PDB Entry: 1aro (more details), 2.8 Å

PDB Description: t7 rna polymerase complexed with t7 lysozyme
PDB Compounds: (L:) T7 lysozyme

SCOPe Domain Sequences for d1arol_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1arol_ d.118.1.1 (L:) Bacteriophage T7 lysozyme (Zn amidase) {Bacteriophage T7 [TaxId: 10760]}
rvqfkqrestdaifvhcsatkpsqnvgvreirqwhkeqgwldvgyhfiikrdgtveagrd
emavgshakgynhnsigvclvggiddkgkfdanftpaqmqslrsllvtllakyegavlra
hhevapkacpsfdlkrwweknelvtsdrg

SCOPe Domain Coordinates for d1arol_:

Click to download the PDB-style file with coordinates for d1arol_.
(The format of our PDB-style files is described here.)

Timeline for d1arol_: