| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.71: LYR proteins from mammalian respiratory complex I [418731] (1 superfamily) three-helix bundle, with long extended loops that interact with other subunits |
Superfamily f.71.1: LYR protein-like [418775] (2 families) ![]() |
| Family f.71.1.1: LYR proteins [418863] (4 proteins) |
| Protein LYR motif-containing protein 4 [419218] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [419736] (8 PDB entries) |
| Domain d5usrd_: 5usr D: [410566] Other proteins in same PDB: d5usra1, d5usra2, d5usrc_, d5usre1, d5usre2, d5usrg1, d5usrg2, d5usri_, d5usrj_, d5usrk_, d5usrl_ automated match to d5usrb_ complexed with 8q1 |
PDB Entry: 5usr (more details), 3.09 Å
SCOPe Domain Sequences for d5usrd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5usrd_ f.71.1.1 (D:) LYR motif-containing protein 4 {Human (Homo sapiens) [TaxId: 9606]}
ssraqvlalyramlreskrfsaynyrtyavrrirdafrenknvkdpveiqtlvnkakrdl
gvirrqvhigqlystdklii
Timeline for d5usrd_: