Lineage for d5usrb_ (5usr B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029490Fold f.71: LYR proteins from mammalian respiratory complex I [418731] (1 superfamily)
    three-helix bundle, with long extended loops that interact with other subunits
  4. 3029491Superfamily f.71.1: LYR protein-like [418775] (2 families) (S)
  5. 3029492Family f.71.1.1: LYR proteins [418863] (4 proteins)
  6. 3029493Protein LYR motif-containing protein 4 [419218] (1 species)
  7. 3029494Species Human (Homo sapiens) [TaxId:9606] [419736] (8 PDB entries)
  8. 3029501Domain d5usrb_: 5usr B: [410565]
    Other proteins in same PDB: d5usra1, d5usra2, d5usrc_, d5usre1, d5usre2, d5usrg1, d5usrg2, d5usri_, d5usrj_, d5usrk_, d5usrl_
    complexed with 8q1

Details for d5usrb_

PDB Entry: 5usr (more details), 3.09 Å

PDB Description: crystal structure of human nfs1-isd11 in complex with e. coli acyl- carrier protein at 3.09 angstroms
PDB Compounds: (B:) LYR motif-containing protein 4

SCOPe Domain Sequences for d5usrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5usrb_ f.71.1.1 (B:) LYR motif-containing protein 4 {Human (Homo sapiens) [TaxId: 9606]}
ssraqvlalyramlreskrfsaynyrtyavrrirdafrenknvkdpveiqtlvnkakrdl
gvirrqvhigqlystd

SCOPe Domain Coordinates for d5usrb_:

Click to download the PDB-style file with coordinates for d5usrb_.
(The format of our PDB-style files is described here.)

Timeline for d5usrb_:

  • d5usrb_ is new in SCOPe 2.08-stable