Lineage for d5ushh_ (5ush H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757217Domain d5ushh_: 5ush H: [410562]
    Other proteins in same PDB: d5usha_, d5ushe2, d5ushl2, d5ushx1, d5ushx2
    automated match to d6shgh_

Details for d5ushh_

PDB Entry: 5ush (more details), 2.3 Å

PDB Description: structure of vaccinia virus d8 protein bound to human fab vv66
PDB Compounds: (H:) Fab vv66 heavy chain

SCOPe Domain Sequences for d5ushh_:

Sequence, based on SEQRES records: (download)

>d5ushh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqlqesgpglvkpsetlsltctisgdsissnnyywgwirqppgkglewigsiyysgstyy
npslksrvtisvdtsknqfslklssvtaadtavyycarhrrvllwfgefqlwgqgtlvtv
ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkve

Sequence, based on observed residues (ATOM records): (download)

>d5ushh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqlqesgpglvkpsetlsltctisgdsissnnyywgwirqppgkglewigsiyysgstyy
npslksrvtisvdtsknqfslklssvtaadtavyycarhrrvllwfgefqlwgqgtlvtv
ssastkgpsvfplapstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkve

SCOPe Domain Coordinates for d5ushh_:

Click to download the PDB-style file with coordinates for d5ushh_.
(The format of our PDB-style files is described here.)

Timeline for d5ushh_:

  • d5ushh_ is new in SCOPe 2.08-stable