Lineage for d1b5ea_ (1b5e A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. Protein dCMP hydroxymethylase [55843] (1 species)
  7. Species Bacteriophage T4 [TaxId:10665] [55844] (6 PDB entries)
  8. Domain d1b5ea_: 1b5e A: [41056]
    complexed with dcm

Details for d1b5ea_

PDB Entry: 1b5e (more details), 1.6 Å

PDB Description: dcmp hydroxymethylase from t4
PDB Compounds: (A:) protein (deoxycytidylate hydroxymethylase)

SCOPe Domain Sequences for d1b5ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b5ea_ d.117.1.1 (A:) dCMP hydroxymethylase {Bacteriophage T4 [TaxId: 10665]}
misdsmtveeirlhlglalkekdfvvdktgvktieiigasfvadepfifgalndeyiqre
lewykskslfvkdipgetpkiwqqvasskgeinsnygwaiwsednyaqydmclaelgqnp
dsrrgimiytrpsmqfdynkdgmsdfmctntvqylirdkkinavvnmrsndvvfgfrndy
awqkyvldklvsdlnagdstrqykagsiiwnvgslhvysrhfylvdhwwktgethiskkd
y

SCOPe Domain Coordinates for d1b5ea_ are not available.

Timeline for d1b5ea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b5eb_