SCOPe 2.08: Domain d5ur8a1: 5ur8 A:1-226

Lineage for d5ur8a1 (5ur8 A:1-226)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5ur8a1: 5ur8 A:1-226 [410557]
   Other proteins in same PDB: d5ur8a2
   automated match to d6shgh_

Details for d5ur8a1

PDB Entry: 5ur8, 1.76 Å

PDB Description: human antibody fragment (fab) to meningococcal factor h binding protein

PDB Compounds: (A:) human immunoglobulin gamma, heavy chain Fd fragment

SCOPe Domain Sequences for d5ur8a1:

Sequence; same for both SEQRES and ATOM records:

>d5ur8a1 b.1.1.0 (A:1-226) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaelkkpgeslkisckasgytftnywvvwvrqmpgeglewmgsihprdsdary
slsfegrvtfsvdkstttaylqwsslkvsdsaiyycarlsqvsgwspwvgpwgqgtlvtv
ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd

Timeline for d5ur8a1:

• d5ur8a1 is new in SCOPe 2.08-stable