SCOPe 2.08: Domain d5ukrh1: 5ukr H:6-215

Lineage for d5ukrh1 (5ukr H:6-215)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries)

8. Domain d5ukrh1: 5ukr H:6-215 [410549]
   Other proteins in same PDB: d5ukrh2, d5ukrl2
   automated match to d6shgh_
   complexed with nag

Details for d5ukrh1

PDB Entry: 5ukr, 2.71 Å

PDB Description: structure of unliganded anti-gp120 cd4bs antibody dh522.2 fab in complex with a gp120 core

PDB Compounds: (H:) DH522.2 Fab fragment heavy chain

SCOPe Domain Sequences for d5ukrh1:

Sequence, based on SEQRES records:

>d5ukrh1 b.1.1.0 (H:6-215) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
esgpglvkpsetlsltcavsggsigddyywnwirqspgkglewigsiygsfggtnfnpsl
knrvtismdtsnnqvslklnsvtaadtavyycargshsivvlfgyyfdywgqgvlvtvss
astkgpsvfplapssrstsestaalgclvkdyfpepvtvswnsgsltsgvhtfpavlqss
glyslssvvtvpssslgtqtyvcnvnhkpsntkvdkrveikt

Sequence, based on observed residues (ATOM records):

>d5ukrh1 b.1.1.0 (H:6-215) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
esgpglvkpsetlsltcavsggsigddyywnwirqspgkglewigsiygsfggtnfnpsl
knrvtismdtsnnqvslklnsvtaadtavyycargshsivvlfgyyfdywgqgvlvtvss
astkgpsvfplapestaalgclvkdyfpepvtvswnsgsltsgvhtfpavlqssglysls
svvtvpssslgtqtyvcnvnhkpsntkvdkrveikt

Timeline for d5ukrh1:

• d5ukrh1 is new in SCOPe 2.08-stable