Lineage for d5tlkd_ (5tlk D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744859Domain d5tlkd_: 5tlk D: [410499]
    Other proteins in same PDB: d5tlka1, d5tlka2, d5tlkb_, d5tlkc1, d5tlkc2, d5tlke1, d5tlke2, d5tlkf_, d5tlkg1, d5tlkg2
    automated match to d6shgh_

Details for d5tlkd_

PDB Entry: 5tlk (more details), 2.7 Å

PDB Description: complex between human cd27 and fab fragments of antibodies m2177 and h2191
PDB Compounds: (D:) h2191 heavy chain

SCOPe Domain Sequences for d5tlkd_:

Sequence, based on SEQRES records: (download)

>d5tlkd_ b.1.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlvesggglvkpggslrlscaasgftfssygmswirqapgkglewvsyidegggqtiy
pdsvkgrftisrdnaknslylqmnslraedtavyycarhrgnpfdywgqgtlvtvssast
kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d5tlkd_ b.1.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlvesggglvkpggslrlscaasgftfssygmswirqapgkglewvsyidegggqtiy
pdsvkgrftisrdnaknslylqmnslraedtavyycarhrgnpfdywgqgtlvtvssast
kgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d5tlkd_:

Click to download the PDB-style file with coordinates for d5tlkd_.
(The format of our PDB-style files is described here.)

Timeline for d5tlkd_:

  • d5tlkd_ is new in SCOPe 2.08-stable