Lineage for d1rtsa_ (1rts A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972208Protein Thymidylate synthase [55833] (7 species)
  7. 2972560Species Norway rat (Rattus norvegicus) [TaxId:10116] [55839] (2 PDB entries)
  8. 2972561Domain d1rtsa_: 1rts A: [41047]
    complexed with d16, ump

Details for d1rtsa_

PDB Entry: 1rts (more details), 3.3 Å

PDB Description: thymidylate synthase from rat in ternary complex with dump and tomudex
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1rtsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rtsa_ d.117.1.1 (A:) Thymidylate synthase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qhgelqylrqvehimrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgady
kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
iqlqreprpfpklrilrkvetiddfkvedfqiegynphpt

SCOPe Domain Coordinates for d1rtsa_:

Click to download the PDB-style file with coordinates for d1rtsa_.
(The format of our PDB-style files is described here.)

Timeline for d1rtsa_: