Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d5sx4j1: 5sx4 J:6-218 [410462] Other proteins in same PDB: d5sx4h2, d5sx4i2, d5sx4j2, d5sx4l2, d5sx4m1, d5sx4m2, d5sx4m3, d5sx4n1, d5sx4n2, d5sx4n3 automated match to d6shgh_ complexed with 1pe, edo, gol, so4 |
PDB Entry: 5sx4 (more details), 2.8 Å
SCOPe Domain Sequences for d5sx4j1:
Sequence, based on SEQRES records: (download)
>d5sx4j1 b.1.1.0 (J:6-218) automated matches {Human (Homo sapiens) [TaxId: 9606]} esgpglvkpsetlsltctvsggsvssgdyywtwirqspgkglewighiyysgntnynpsl ksrltisidtsktqfslklssvtaadtaiyycvrdrvtgafdiwgqgtmvtvssastkgp svfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls svvtvpssnfgtqtytcnvdhkpsntkvdktve
>d5sx4j1 b.1.1.0 (J:6-218) automated matches {Human (Homo sapiens) [TaxId: 9606]} esgpglvkpsetlsltctvsggsvssgdyywtwirqspgkglewighiyysgntnynpsl ksrltisidtsktqfslklssvtaadtaiyycvrdrvtgafdiwgqgtmvtvssastkgp svfplapctaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpq tytcnvdhkpsntkvdktve
Timeline for d5sx4j1: