Lineage for d5sx4h1 (5sx4 H:6-218)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758791Domain d5sx4h1: 5sx4 H:6-218 [410460]
    Other proteins in same PDB: d5sx4h2, d5sx4i2, d5sx4j2, d5sx4l2, d5sx4m1, d5sx4m2, d5sx4m3, d5sx4n1, d5sx4n2, d5sx4n3
    automated match to d6shgh_
    complexed with 1pe, edo, gol, so4

Details for d5sx4h1

PDB Entry: 5sx4 (more details), 2.8 Å

PDB Description: crystal structure of panitumumab in complex with epidermal growth factor receptor domain 3.
PDB Compounds: (H:) Panitumumab Fab Heavy Chain

SCOPe Domain Sequences for d5sx4h1:

Sequence, based on SEQRES records: (download)

>d5sx4h1 b.1.1.0 (H:6-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkpsetlsltctvsggsvssgdyywtwirqspgkglewighiyysgntnynpsl
ksrltisidtsktqfslklssvtaadtaiyycvrdrvtgafdiwgqgtmvtvssastkgp
svfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssnfgtqtytcnvdhkpsntkvdktve

Sequence, based on observed residues (ATOM records): (download)

>d5sx4h1 b.1.1.0 (H:6-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkpsetlsltctvsggsvssgdyywtwirqspgkglewighiyysgntnynpsl
ksrltisidtsktqfslklssvtaadtaiyycvrdrvtgafdiwgqgtmvtvssastkgp
svfplapcsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvt
vpstqtytcnvdhkpsntkvdktve

SCOPe Domain Coordinates for d5sx4h1:

Click to download the PDB-style file with coordinates for d5sx4h1.
(The format of our PDB-style files is described here.)

Timeline for d5sx4h1:

  • d5sx4h1 is new in SCOPe 2.08-stable