Lineage for d2tsrc_ (2tsr C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212075Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2212113Protein Thymidylate synthase [55833] (7 species)
  7. 2212375Species Norway rat (Rattus norvegicus) [TaxId:10116] [55839] (2 PDB entries)
  8. 2212378Domain d2tsrc_: 2tsr C: [41045]
    complexed with d16, ump

Details for d2tsrc_

PDB Entry: 2tsr (more details), 2.6 Å

PDB Description: thymidylate synthase from rat in ternary complex with dump and tomudex
PDB Compounds: (C:) Thymidylate synthase

SCOPe Domain Sequences for d2tsrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tsrc_ d.117.1.1 (C:) Thymidylate synthase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qhgelqylrqvehimrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgady
kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
iqlqreprpfpklrilrkvetiddfkvedfqiegynphpti

SCOPe Domain Coordinates for d2tsrc_:

Click to download the PDB-style file with coordinates for d2tsrc_.
(The format of our PDB-style files is described here.)

Timeline for d2tsrc_: