SCOPe 2.08: Domain d5ocab2: 5oca B:454-682

Lineage for d5ocab2 (5oca B:454-682)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.77: Resistin [111422] (1 superfamily)
   disulfide-rich six-stranded beta-sandwich; jelly-roll

4. Superfamily g.77.1: Resistin [111423] (2 families)
   automatically mapped to Pfam PF06954

5. Family g.77.1.2: PCSK9 C-terminal domain-like [418873] (2 proteins)
   Pfam PF18459, Pfam PF18463, Pfam PF18464
   Homology of C-terminal domain to concatenation of three resistin-like monomers discussed in PubMed 17804797

6. Protein automated matches [419239] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [419823] (11 PDB entries)

8. Domain d5ocab2: 5oca B:454-682 [410445]
   Other proteins in same PDB: d5ocab1, d5ocah_, d5ocal1, d5ocal2
   automated match to d2p4ea2
   complexed with na, twa, twd

Details for d5ocab2

PDB Entry: 5oca, 2.3 Å

PDB Description: pcsk9:fab complex with dextran sulfate

PDB Compounds: (B:) Proprotein convertase subtilisin/kexin type 9

SCOPe Domain Sequences for d5ocab2:

Sequence, based on SEQRES records:

>d5ocab2 g.77.1.2 (B:454-682) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlfcrtvwsahsgptrmataiarcapdeellscssfsrsgkrrgermeaqggklvcrahn
afggegvyaiarccllpqaacsvhtappaeasmgtrvhchqqghvltgcsshwevedlgt
hkppvlrprgqpnqcvghreasihascchapgleckvkehgipapqgqvtvaceegwtlt
gcsalpgtshvlgayavdntcvvrsrdvsttgstseeavtavaiccrsr

Sequence, based on observed residues (ATOM records):

>d5ocab2 g.77.1.2 (B:454-682) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlfcrtvwsahsgptrmataiarcapdeellscssfsrsgkrrgermeaqggklvcrahn
afggegvyaiarccllpqaacsvhtappaeasmgtrvhchqqghvltgcsshwevedlgt
pnqcvghreasihascchapgleckvkehgipapqgqvtvaceegwtltgcsalpgtshv
lgayavdntcvvrsravtavaiccrsr

Timeline for d5ocab2:

• d5ocab2 is new in SCOPe 2.08-stable