![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
![]() | Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
![]() | Protein automated matches [190988] (51 species) not a true protein |
![]() | Species Norwalk virus [TaxId:11983] [419865] (22 PDB entries) |
![]() | Domain d5o04a_: 5o04 A: [410422] Other proteins in same PDB: d5o04c1, d5o04c2, d5o04c3, d5o04d1, d5o04d2, d5o04e1, d5o04e2, d5o04f1, d5o04f2 automated match to d5or7a_ complexed with edo |
PDB Entry: 5o04 (more details), 2.3 Å
SCOPe Domain Sequences for d5o04a_:
Sequence, based on SEQRES records: (download)
>d5o04a_ b.121.4.0 (A:) automated matches {Norwalk virus [TaxId: 11983]} pftlpiltlgeltnsrfplpidvlytnpnesaivqcqngrctldgelqgttqllptgica frgkvtqqvqdehrgthwnmtvtnlngtpfdptedvpaplgtpdfsgqiygvisqrntnt vpgegnlpanraheaviatyspkftpklgniqfstwetqdvssgqptkftpvglasvdan shfdqwtlpsysgaltlnmnlapsvapvfpgecllffrsfiplkggygnpaidclmpqew vqhlyqesapslsdvalvryvnpetgrtlfeaklhrngfltvarnsagpvvaptngyfrf dswvnqfytlapm
>d5o04a_ b.121.4.0 (A:) automated matches {Norwalk virus [TaxId: 11983]} pftlpiltlgeltnsrfplpidvlytnpnesaivqcqngrctldgelqgttqllptgica frgkvtqqvqdehrgthwnmtvtnlngtpfdptedvpaplgtpdfsgqiygvisqrntng nlpanraheaviatyspkftpklgniqfstwetqdvssgqptkftpvglasvdanshfdq wtlpsysgaltlnmnlapsvapvfpgecllffrsfiplkggygnpaidclmpqewvqhly qesapslsdvalvryvnpetgrtlfeaklhrngfltvarnsagpvvaptngyfrfdswvn qfytlapm
Timeline for d5o04a_: