Lineage for d1ci7b_ (1ci7 B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. Protein Thymidylate synthase [55833] (7 species)
  7. Species Fungus (Pneumocystis carinii) [TaxId:4754] [55838] (2 PDB entries)
  8. Domain d1ci7b_: 1ci7 B: [41042]
    complexed with cb3, ump

Details for d1ci7b_

PDB Entry: 1ci7 (more details), 2.6 Å

PDB Description: ternary complex of thymidylate synthase from pneumocystis carinii
PDB Compounds: (B:) protein (thymidylate synthase)

SCOPe Domain Sequences for d1ci7b_:

Sequence, based on SEQRES records: (download)

>d1ci7b_ d.117.1.1 (B:) Thymidylate synthase {Fungus (Pneumocystis carinii) [TaxId: 4754]}
naeeqqylnlvqyiinhgedrpdrtgtgtlsvfapsplkfslrnktfpllttkrvfirgv
ieellwfirgetdslklreknihiwdangsreyldsigltkrqegdlgpiygfqwrhfga
eyidcktnyigqgvdqlaniiqkirtspydrrlilsawnpadlekmalppchmfcqfyvh
ipsnnhrpelscqlyqrscdmglgvpfniasyalltcmiahvcdldpgdfihvmgdchiy
kdhiealqqqltrsprpfptlslnrsitdiedftlddfniqnyhpyetikmkmsi

Sequence, based on observed residues (ATOM records): (download)

>d1ci7b_ d.117.1.1 (B:) Thymidylate synthase {Fungus (Pneumocystis carinii) [TaxId: 4754]}
naeeqqylnlvqyiinhgedrpdrtgtgtlsvfapsplkfslrnktfpllttkrvfirgv
ieellwfirgetdslklreknihiwdangsreyldsigltkrqegdlgpiygfqwrhfga
eyidcktnyigqgvdqlaniiqkirtspydrrlilsawnpadlekmalppchmfcqfyvh
ipsrpelscqlyqrscdmglgvpfniasyalltcmiahvcdldpgdfihvmgdchiykdh
iealqqqltrsprpfptlslnrsitdiedftlddfniqnyhpyetikmkmsi

SCOPe Domain Coordinates for d1ci7b_ are not available.

Timeline for d1ci7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ci7a_