![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
![]() | Domain d5nbwb_: 5nbw B: [410412] Other proteins in same PDB: d5nbwa1, d5nbwa2, d5nbwl1, d5nbwl2 automated match to d6shgh_ complexed with 8sk |
PDB Entry: 5nbw (more details), 2.4 Å
SCOPe Domain Sequences for d5nbwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nbwb_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} evklhqsgaelvnpgasvkisckapgytfnnywiewvkqrpghglewigeilpgsgriny nekfkdkatftadtssntaymqlssltsddsavyycakkygdywgqgttvtvssakttpp svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss svtvpsstwpsetvtcnvahpasstkvdkkivprdc
Timeline for d5nbwb_: