Lineage for d5nbwb_ (5nbw B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744934Domain d5nbwb_: 5nbw B: [410412]
    Other proteins in same PDB: d5nbwa1, d5nbwa2, d5nbwl1, d5nbwl2
    automated match to d6shgh_
    complexed with 8sk

Details for d5nbwb_

PDB Entry: 5nbw (more details), 2.4 Å

PDB Description: crystal structure of the fab fragment 22f12 in complex with 3- hydroxybenzo[a]pyrene
PDB Compounds: (B:) Fab 22F12 (A,B)

SCOPe Domain Sequences for d5nbwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nbwb_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklhqsgaelvnpgasvkisckapgytfnnywiewvkqrpghglewigeilpgsgriny
nekfkdkatftadtssntaymqlssltsddsavyycakkygdywgqgttvtvssakttpp
svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
svtvpsstwpsetvtcnvahpasstkvdkkivprdc

SCOPe Domain Coordinates for d5nbwb_:

Click to download the PDB-style file with coordinates for d5nbwb_.
(The format of our PDB-style files is described here.)

Timeline for d5nbwb_:

  • d5nbwb_ is new in SCOPe 2.08-stable