Lineage for d1tisa_ (1tis A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2578767Protein Thymidylate synthase [55833] (7 species)
  7. 2578780Species Bacteriophage T4 [TaxId:10665] [55837] (1 PDB entry)
  8. 2578781Domain d1tisa_: 1tis A: [41040]
    complexed with po4

Details for d1tisa_

PDB Entry: 1tis (more details), 2.7 Å

PDB Description: crystal structure of thymidylate synthase from t4 phage
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1tisa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tisa_ d.117.1.1 (A:) Thymidylate synthase {Bacteriophage T4 [TaxId: 10665]}
mkqyqdlikdifengyetddrtgtgtialfgsklrwdltkgfpavttkklawkaciaeli
wflsgstnvndlrliqhdsliqgktvwdenyenqakdlgyhsgelgpiygkqwrdfggvd
qiievidrikklpndrrqivsawnpaelkymalppchmfyqfnvrngyldlqwyqrsvdv
flglpfniasyatlvhivakmcnlipgdlifsggnthiymnhveqckeilrrepkelcel
visglpykfrylstkeqlkyvlklrpkdfvlnnyvshppikgkmav

SCOPe Domain Coordinates for d1tisa_:

Click to download the PDB-style file with coordinates for d1tisa_.
(The format of our PDB-style files is described here.)

Timeline for d1tisa_: