Lineage for d1tis__ (1tis -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Bacteriophage T4 [TaxId:10665] [55837] (1 PDB entry) 
Domain d1tis__: 1tis - [41040]
Details for d1tis__
PDB Entry: 1tis (more details), 3.1 Å
PDB Description: crystal structure of thymidylate synthase from t4 phage
SCOP Domain Sequences for d1tis__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tis__ d.117.1.1 (-) Thymidylate synthase {Bacteriophage T4}
mkqyqdlikdifengyetddrtgtgtialfgsklrwdltkgfpavttkklawkaciaeli
wflsgstnvndlrliqhdsliqgktvwdenyenqakdlgyhsgelgpiygkqwrdfggvd
qiievidrikklpndrrqivsawnpaelkymalppchmfyqfnvrngyldlqwyqrsvdv
flglpfniasyatlvhivakmcnlipgdlifsggnthiymnhveqckeilrrepkelcel
visglpykfrylstkeqlkyvlklrpkdfvlnnyvshppikgkmav
SCOP Domain Coordinates for d1tis__:
Click to download the PDB-style file with coordinates for d1tis__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tis__:
- d1tis__ appears in SCOP 1.57
- d1tis__ appears in the current release, SCOPe 2.08, called d1tisa_
View in 3D