SCOPe 2.08: Domain d5mo9h1: 5mo9 H:9-217

Lineage for d5mo9h1 (5mo9 H:9-217)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5mo9h1: 5mo9 H:9-217 [410391]
   Other proteins in same PDB: d5mo9h2, d5mo9l1
   automated match to d6shgh_

Details for d5mo9h1

PDB Entry: 5mo9, 2.59 Å

PDB Description: structure of human trkb receptor ligand binding domain in complex with the fab frgment of antibody ab20

PDB Compounds: (H:) AB20 Fab heavy chain

SCOPe Domain Sequences for d5mo9h1:

Sequence, based on SEQRES records:

>d5mo9h1 b.1.1.0 (H:9-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aelvrpgasvtlsckasgytftdyemhwvkqtpvhglewigtidpetagtaynqkfkgka
iltagkssstaymelrsltsedsavyyctgvttwfaywgqgtlvtvsaastkgpsvfpla
psskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvp
ssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records):

>d5mo9h1 b.1.1.0 (H:9-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aelvrpgasvtlsckasgytftdyemhwvkqtpvhglewigtidpetagtaynqkfkgka
iltagkssstaymelrsltsedsavyyctgvttwfaywgqgtlvtvsaastkgpsvfpla
psggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslg
tqtyicnvnhkpsntkvdkkvepk

Timeline for d5mo9h1:

• d5mo9h1 is new in SCOPe 2.08-stable