Lineage for d5mi0b_ (5mi0 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744887Domain d5mi0b_: 5mi0 B: [410390]
    Other proteins in same PDB: d5mi0c1, d5mi0c2
    automated match to d6shgh_

Details for d5mi0b_

PDB Entry: 5mi0 (more details), 2.35 Å

PDB Description: a thermally stabilised version of plasmodium falciparum rh5
PDB Compounds: (B:) monoclonal antibody 9ad4

SCOPe Domain Sequences for d5mi0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mi0b_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vklvesgggvvqpggsrklscaasgftfsdygmawvrqapgkgpewvtfisnmaysiyya
dtvtgrftisrenakntlhlemsslrsedtamyyctraifdyagywyfdvwgagttvtvs
sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOPe Domain Coordinates for d5mi0b_:

Click to download the PDB-style file with coordinates for d5mi0b_.
(The format of our PDB-style files is described here.)

Timeline for d5mi0b_:

  • d5mi0b_ is new in SCOPe 2.08-stable