Lineage for d1bkob_ (1bko B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2578767Protein Thymidylate synthase [55833] (7 species)
  7. 2578768Species Bacillus subtilis [TaxId:1423] [55836] (5 PDB entries)
  8. 2578777Domain d1bkob_: 1bko B: [41037]

Details for d1bkob_

PDB Entry: 1bko (more details), 2.75 Å

PDB Description: thermostable thymidylate synthase a from bacillus subtilis
PDB Compounds: (B:) thymidylate synthase a

SCOPe Domain Sequences for d1bkob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkob_ d.117.1.1 (B:) Thymidylate synthase {Bacillus subtilis [TaxId: 1423]}
tqfdkqynsiikdiinngisdeefdvrtkwdsdgtpahtlsviskqmrfdnsevpilttk
kvawktaikellwiwqlksndvndlnmmgvhiwdqwkqedgtighaygfqlgkknrslng
ekvdqvdyllhqlknnpssrrhitmlwnpdeldamaltpcvyetqwyvkhgklhlevrar
sndmalgnpfnvfqynvlqrmiaqvtgyelgeyifnigdchvytrhidnlkiqmereqfe
apelwinpevkdfydftiddfklinykhgdkllfevav

SCOPe Domain Coordinates for d1bkob_:

Click to download the PDB-style file with coordinates for d1bkob_.
(The format of our PDB-style files is described here.)

Timeline for d1bkob_: