| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily) core: three transmembrane helices, bundle |
Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) ![]() automatically mapped to Pfam PF02605 |
| Family f.31.1.0: automated matches [375525] (1 protein) not a true family |
| Protein automated matches [375526] (6 species) not a true protein |
| Species Pea (Pisum sativum) [TaxId:3888] [419925] (8 PDB entries) |
| Domain d5l8rl_: 5l8r L: [410366] Other proteins in same PDB: d5l8r1_, d5l8r2_, d5l8r3_, d5l8r4_, d5l8ra_, d5l8rb_, d5l8rc_, d5l8rd_, d5l8re1, d5l8re2, d5l8rf_, d5l8rj_ automated match to d6k61l_ complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat, zex |
PDB Entry: 5l8r (more details), 2.6 Å
SCOPe Domain Sequences for d5l8rl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l8rl_ f.31.1.0 (L:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
yqvvqpingdpfigsletpvtssplvawylsnlpgyrtavnpllrgievglahgfllvgp
fvkagplrnteiagqagslaagglvvilsicltiygissfnegdpstapsltltgrkkqp
dqlqtadgwakftggfffggisgviwaffllyvldlp
Timeline for d5l8rl_: