Lineage for d5l8rl_ (5l8r L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027932Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 3027933Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) (S)
    automatically mapped to Pfam PF02605
  5. 3027955Family f.31.1.0: automated matches [375525] (1 protein)
    not a true family
  6. 3027956Protein automated matches [375526] (6 species)
    not a true protein
  7. 3027971Species Pea (Pisum sativum) [TaxId:3888] [419925] (8 PDB entries)
  8. 3027977Domain d5l8rl_: 5l8r L: [410366]
    Other proteins in same PDB: d5l8r1_, d5l8r2_, d5l8r3_, d5l8r4_, d5l8ra_, d5l8rb_, d5l8rc_, d5l8rd_, d5l8re1, d5l8re2, d5l8rf_, d5l8rj_
    automated match to d6k61l_
    complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat, zex

Details for d5l8rl_

PDB Entry: 5l8r (more details), 2.6 Å

PDB Description: the structure of plant photosystem i super-complex at 2.6 angstrom resolution.
PDB Compounds: (L:) Putative uncharacterized protein

SCOPe Domain Sequences for d5l8rl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l8rl_ f.31.1.0 (L:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
yqvvqpingdpfigsletpvtssplvawylsnlpgyrtavnpllrgievglahgfllvgp
fvkagplrnteiagqagslaagglvvilsicltiygissfnegdpstapsltltgrkkqp
dqlqtadgwakftggfffggisgviwaffllyvldlp

SCOPe Domain Coordinates for d5l8rl_:

Click to download the PDB-style file with coordinates for d5l8rl_.
(The format of our PDB-style files is described here.)

Timeline for d5l8rl_:

  • d5l8rl_ is new in SCOPe 2.08-stable