Lineage for d1bkoa_ (1bko A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83365Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
  4. 83366Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 83367Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 83379Protein Thymidylate synthase [55833] (7 species)
  7. 83380Species Bacillus subtilis [TaxId:1423] [55836] (5 PDB entries)
  8. 83388Domain d1bkoa_: 1bko A: [41036]

Details for d1bkoa_

PDB Entry: 1bko (more details), 2.75 Å

PDB Description: thermostable thymidylate synthase a from bacillus subtilis

SCOP Domain Sequences for d1bkoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkoa_ d.117.1.1 (A:) Thymidylate synthase {Bacillus subtilis}
tqfdkqynsiikdiinngisdeefdvrtkwdsdgtpahtlsviskqmrfdnsevpilttk
kvawktaikellwiwqlksndvndlnmmgvhiwdqwkqedgtighaygfqlgkknrslng
ekvdqvdyllhqlknnpssrrhitmlwnpdeldamaltpcvyetqwyvkhgklhlevrar
sndmalgnpfnvfqynvlqrmiaqvtgyelgeyifnigdchvytrhidnlkiqmereqfe
apelwinpevkdfydftiddfklinykhgdkllfevav

SCOP Domain Coordinates for d1bkoa_:

Click to download the PDB-style file with coordinates for d1bkoa_.
(The format of our PDB-style files is described here.)

Timeline for d1bkoa_: