Lineage for d1b02a_ (1b02 A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) Species Bacillus subtilis [TaxId:1423] [55836] (5 PDB entries) 
Domain d1b02a_: 1b02 A: [41035]
Details for d1b02a_
PDB Entry: 1b02 (more details), 2.5 Å
PDB Description: crystal structure of thymidylate synthase a from bacillus subtilis
SCOP Domain Sequences for d1b02a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b02a_ d.117.1.1 (A:) Thymidylate synthase {Bacillus subtilis}
mtqfdkqynsiikdiinngisdeefdvrtkwdsdgtpahtlsviskqmrfdnsevpiltt
kkvawktaikellwiwqlksndvndlnmmgvhiwdqwkqedgtighaygfqlgkknrsln
gekvdqvdyllhqlknnpssrrhitmlwnpdeldamaltpcvyetqwyvkhgklhlevra
rsndmalgnpfnvfqynvlqrmiaqvtgyelgeyifnigdchvytrhidnlkiqmereqf
eapelwinpevkdfydftiddfklinykhgdkllfevav
SCOP Domain Coordinates for d1b02a_:
Click to download the PDB-style file with coordinates for d1b02a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b02a_:
- d1b02a_ appears in SCOP 1.57
- d1b02a_ appears in the current release, SCOPe 2.08
View in 3D