Lineage for d1b02a_ (1b02 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972208Protein Thymidylate synthase [55833] (7 species)
  7. 2972209Species Bacillus subtilis [TaxId:1423] [55836] (5 PDB entries)
  8. 2972216Domain d1b02a_: 1b02 A: [41035]
    complexed with c2f, ufp

Details for d1b02a_

PDB Entry: 1b02 (more details), 2.5 Å

PDB Description: crystal structure of thymidylate synthase a from bacillus subtilis
PDB Compounds: (A:) protein (thymidylate synthase)

SCOPe Domain Sequences for d1b02a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b02a_ d.117.1.1 (A:) Thymidylate synthase {Bacillus subtilis [TaxId: 1423]}
mtqfdkqynsiikdiinngisdeefdvrtkwdsdgtpahtlsviskqmrfdnsevpiltt
kkvawktaikellwiwqlksndvndlnmmgvhiwdqwkqedgtighaygfqlgkknrsln
gekvdqvdyllhqlknnpssrrhitmlwnpdeldamaltpcvyetqwyvkhgklhlevra
rsndmalgnpfnvfqynvlqrmiaqvtgyelgeyifnigdchvytrhidnlkiqmereqf
eapelwinpevkdfydftiddfklinykhgdkllfevav

SCOPe Domain Coordinates for d1b02a_:

Click to download the PDB-style file with coordinates for d1b02a_.
(The format of our PDB-style files is described here.)

Timeline for d1b02a_: