Lineage for d1bsfb_ (1bsf B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2578767Protein Thymidylate synthase [55833] (7 species)
  7. 2578768Species Bacillus subtilis [TaxId:1423] [55836] (5 PDB entries)
  8. 2578774Domain d1bsfb_: 1bsf B: [41034]

Details for d1bsfb_

PDB Entry: 1bsf (more details), 2.2 Å

PDB Description: thermostable thymidylate synthase a from bacillus subtilis
PDB Compounds: (B:) thymidylate synthase a

SCOPe Domain Sequences for d1bsfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bsfb_ d.117.1.1 (B:) Thymidylate synthase {Bacillus subtilis [TaxId: 1423]}
tqfdkqynsiikdiinngisdeefdvrtkwdsdgtpahtlsviskqmrfdnsevpilttk
kvawktaikellwiwqlksndvndlnmmgvhiwdqwkqedgtighaygfqlgkknrslng
ekvdqvdyllhqlknnpssrrhitmlwnpdeldamaltpcvyetqwyvkhgklhlevrar
sndmalgnpfnvfqynvlqrmiaqvtgyelgeyifnigdchvytrhidnlkiqmereqfe
apelwinpevkdfydftiddfklinykhgdkllfevav

SCOPe Domain Coordinates for d1bsfb_:

Click to download the PDB-style file with coordinates for d1bsfb_.
(The format of our PDB-style files is described here.)

Timeline for d1bsfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bsfa_