SCOPe 2.07: Domain d1bspb_: 1bsp B:

Lineage for d1bspb_ (1bsp B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Bacillus subtilis [TaxId:1423] [55836] (5 PDB entries)

8. Domain d1bspb_: 1bsp B: [41032]
   complexed with po4

Details for d1bspb_

PDB Entry: 1bsp, 2.5 Å

PDB Description: thermostable thymidylate synthase a from bacillus subtilis

PDB Compounds: (B:) thymidylate synthase a

SCOPe Domain Sequences for d1bspb_:

Sequence; same for both SEQRES and ATOM records:

>d1bspb_ d.117.1.1 (B:) Thymidylate synthase {Bacillus subtilis [TaxId: 1423]}
tqfdkqynsiikdiinngisdeefdvrtkwdsdgtpahtlsviskqmrfdnsevpilttk
kvawktaikellwiwqlksndvndlnmmgvhiwdqwkqedgtighaygfqlgkknrslng
ekvdqvdyllhqlknnpssrrhitmlwnpdeldamaltpcvyetqwyvkhgklhlevrar
sndmalgnpfnvfqynvlqrmiaqvtgyelgeyifnigdchvytrhidnlkiqmereqfe
apelwinpevkdfydftiddfklinykhgdkllfevav

Timeline for d1bspb_:

• d1bspb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bspb_ appears in SCOPe 2.06
  
• d1bspb_ appears in the current release, SCOPe 2.08