Lineage for d1bspb_ (1bsp B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) Species Bacillus subtilis [TaxId:1423] [55836] (5 PDB entries) 
Domain d1bspb_: 1bsp B: [41032]
Details for d1bspb_
PDB Entry: 1bsp (more details), 2.5 Å
PDB Description: thermostable thymidylate synthase a from bacillus subtilis
SCOP Domain Sequences for d1bspb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bspb_ d.117.1.1 (B:) Thymidylate synthase {Bacillus subtilis}
tqfdkqynsiikdiinngisdeefdvrtkwdsdgtpahtlsviskqmrfdnsevpilttk
kvawktaikellwiwqlksndvndlnmmgvhiwdqwkqedgtighaygfqlgkknrslng
ekvdqvdyllhqlknnpssrrhitmlwnpdeldamaltpcvyetqwyvkhgklhlevrar
sndmalgnpfnvfqynvlqrmiaqvtgyelgeyifnigdchvytrhidnlkiqmereqfe
apelwinpevkdfydftiddfklinykhgdkllfevav
SCOP Domain Coordinates for d1bspb_:
Click to download the PDB-style file with coordinates for d1bspb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bspb_:
- d1bspb_ appears in SCOP 1.57
- d1bspb_ appears in the current release, SCOPe 2.08
View in 3D
