Lineage for d1tdaa_ (1tda A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1666639Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1666640Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1666641Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1666674Protein Thymidylate synthase [55833] (7 species)
  7. Species Lactobacillus casei [TaxId:1582] [55835] (51 PDB entries)
  8. 1666888Domain d1tdaa_: 1tda A: [41027]
    complexed with po4

Details for d1tdaa_

PDB Entry: 1tda (more details), 3.09 Å

PDB Description: structures of thymidylate synthase with a c-terminal deletion: role of the c-terminus in alignment of d/ump and ch2h4folate
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1tdaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdaa_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei [TaxId: 1582]}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapva

SCOPe Domain Coordinates for d1tdaa_:

Click to download the PDB-style file with coordinates for d1tdaa_.
(The format of our PDB-style files is described here.)

Timeline for d1tdaa_: