Lineage for d1tdc__ (1tdc -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35325Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
  4. 35326Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 35327Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 35339Protein Thymidylate synthase [55833] (7 species)
  7. 35421Species Lactobacillus casei [TaxId:1582] [55835] (39 PDB entries)
  8. 35460Domain d1tdc__: 1tdc - [41026]

Details for d1tdc__

PDB Entry: 1tdc (more details), 2.65 Å

PDB Description: structures of thymidylate synthase with a c-terminal deletion: role of the c-terminus in alignment of d/ump and ch2h4folate

SCOP Domain Sequences for d1tdc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdc__ d.117.1.1 (-) Thymidylate synthase {Lactobacillus casei}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapva

SCOP Domain Coordinates for d1tdc__:

Click to download the PDB-style file with coordinates for d1tdc__.
(The format of our PDB-style files is described here.)

Timeline for d1tdc__: