SCOPe 2.06: Domain d1tdba_: 1tdb A:

Lineage for d1tdba_ (1tdb A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Lactobacillus casei [TaxId:1582] [55835] (51 PDB entries)

8. Domain d1tdba_: 1tdb A: [41025]
   complexed with ufp

Details for d1tdba_

PDB Entry: 1tdb, 2.65 Å

PDB Description: structures of thymidylate synthase with a c-terminal deletion: role of the c-terminus in alignment of d/ump and ch2h4folate

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1tdba_:

Sequence; same for both SEQRES and ATOM records:

>d1tdba_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei [TaxId: 1582]}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapva

Timeline for d1tdba_:

• d1tdba_ first appeared (with stable ids) in SCOP 1.55, called d1tdb__
  
• d1tdba_ appears in SCOPe 2.05
  
• d1tdba_ appears in SCOPe 2.07
  
• d1tdba_ appears in the current release, SCOPe 2.08