Lineage for d1tdba_ (1tdb A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212075Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2212113Protein Thymidylate synthase [55833] (7 species)
  7. 2212323Species Lactobacillus casei [TaxId:1582] [55835] (51 PDB entries)
  8. 2212373Domain d1tdba_: 1tdb A: [41025]
    complexed with ufp

Details for d1tdba_

PDB Entry: 1tdb (more details), 2.65 Å

PDB Description: structures of thymidylate synthase with a c-terminal deletion: role of the c-terminus in alignment of d/ump and ch2h4folate
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1tdba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdba_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei [TaxId: 1582]}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapva

SCOPe Domain Coordinates for d1tdba_:

Click to download the PDB-style file with coordinates for d1tdba_.
(The format of our PDB-style files is described here.)

Timeline for d1tdba_: