Lineage for d1vzb__ (1vzb -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Lactobacillus casei [TaxId:1582] [55835] (39 PDB entries) 
Domain d1vzb__: 1vzb - [41022]
Details for d1vzb__
PDB Entry: 1vzb (more details), 2.5 Å
PDB Description: l. casei thymidylate synthase mutant e60q binary complex with dump
SCOP Domain Sequences for d1vzb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vzb__ d.117.1.1 (-) Thymidylate synthase {Lactobacillus casei}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfgliksq
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkapefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapvav
SCOP Domain Coordinates for d1vzb__:
Click to download the PDB-style file with coordinates for d1vzb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vzb__:
- d1vzb__ appears in SCOP 1.57
- d1vzb__ appears in the current release, SCOPe 2.08, called d1vzba_
View in 3D