Lineage for d5imyb2 (5imy B:405-515)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825970Fold b.183: Perfringolysin C-terminal-like [418707] (1 superfamily)
    all-beta, similar to the CalB domain fold (b.7) but the two last strands are transposed
  4. 2825971Superfamily b.183.1: Perfringolysin C-terminal-like [418736] (1 family) (S)
  5. 2825972Family b.183.1.1: Perfringolysin C-terminal-like [418784] (8 proteins)
  6. 2826014Protein Vaginolysin C-terminal domain [419171] (1 species)
  7. 2826015Species Gardnerella vaginalis [419282] (1 PDB entry)
  8. 2826017Domain d5imyb2: 5imy B:405-515 [410196]
    Other proteins in same PDB: d5imya1, d5imyb1, d5imyc1, d5imyc2, d5imyd1, d5imyd2

Details for d5imyb2

PDB Entry: 5imy (more details), 2.4 Å

PDB Description: trapped toxin
PDB Compounds: (B:) Vaginolysin

SCOPe Domain Sequences for d5imyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5imyb2 b.183.1.1 (B:405-515) Vaginolysin C-terminal domain {Gardnerella vaginalis}
ngyltldhrgayvaryyiywdeygteidgtpyvrsrawegngkyrtahfnttiqfkgnvr
nlriklvektglvwepwrtvydrsdlplvrqrtisnwgttlwprvaetvkn

SCOPe Domain Coordinates for d5imyb2:

Click to download the PDB-style file with coordinates for d5imyb2.
(The format of our PDB-style files is described here.)

Timeline for d5imyb2:

  • d5imyb2 is new in SCOPe 2.08-stable

2826017
d5imyb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5imyb1