Lineage for d5ikch1 (5ikc H:2-215)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744619Domain d5ikch1: 5ikc H:2-215 [410185]
    Other proteins in same PDB: d5ikca1, d5ikca2, d5ikca3, d5ikcb2, d5ikch2, d5ikcl1, d5ikcl2, d5ikcl3, d5ikcm1, d5ikcm2, d5ikcn1, d5ikcn2
    automated match to d6shgh_
    complexed with cl

Details for d5ikch1

PDB Entry: 5ikc (more details), 2.06 Å

PDB Description: x-ray structure of the n-terminal domain of human doublecortin in complex with fab
PDB Compounds: (H:) Ighg protein

SCOPe Domain Sequences for d5ikch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ikch1 b.1.1.1 (H:2-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vqlqqsgadlvrpgasvklsctasgfdikddyvhwvkqrpeqglewigridpangatkya
pkfqdkatltadtssntaylqlssltsedtavyycgrskyfdswgqgttltvssakttpp
svyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmss
svtvpsstwpsqtvtcsvahpassttvdkkleps

SCOPe Domain Coordinates for d5ikch1:

Click to download the PDB-style file with coordinates for d5ikch1.
(The format of our PDB-style files is described here.)

Timeline for d5ikch1:

  • d5ikch1 is new in SCOPe 2.08-stable