Lineage for d5ik3a_ (5ik3 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188740] (689 PDB entries)
  8. Domain d5ik3a_: 5ik3 A: [410181]
    Other proteins in same PDB: d5ik3b1, d5ik3b2, d5ik3d1, d5ik3d2
    automated match to d6shgh_
    complexed with so4

Details for d5ik3a_

PDB Entry: 5ik3 (more details), 1.6500000000000001 Å

PDB Description: crystal structure of anti-gliadin 1002-1e03 fab fragment
PDB Compounds: (A:) 1E03 Fab fragment heavy chain

SCOPe Domain Sequences for d5ik3a_:

Sequence, based on SEQRES records: (download)

>d5ik3a_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvkpggslrlscaasgftfsnawfnwvrqapgkglewvgriktntdggtt
dyaapvkgrftisrddskntlylqmnslktedtavyycttgeplvnhitildywgqgtlv
tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records): (download)

>d5ik3a_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvkpggslrlscaasgftfsnawfnwvrqapgkglewvgriktntdggtt
dyaapvkgrftisrddskntlylqmnslktedtavyycttghitildywgqgtlvtvssa
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d5ik3a_ are not available.

Timeline for d5ik3a_:

  • d5ik3a_ is new in SCOPe 2.08-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d5ik3b1, d5ik3b2, d5ik3c_, d5ik3d1, d5ik3d2