Lineage for d1lcea_ (1lce A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1923787Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1923788Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1923789Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1923827Protein Thymidylate synthase [55833] (7 species)
  7. 1924019Species Lactobacillus casei [TaxId:1582] [55835] (51 PDB entries)
  8. 1924055Domain d1lcea_: 1lce A: [41018]
    complexed with tmf, ump

Details for d1lcea_

PDB Entry: 1lce (more details), 2.5 Å

PDB Description: lactobacillus casei thymidylate synthase ternary complex with dump and ch2thf
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1lcea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lcea_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei [TaxId: 1582]}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapvav

SCOPe Domain Coordinates for d1lcea_:

Click to download the PDB-style file with coordinates for d1lcea_.
(The format of our PDB-style files is described here.)

Timeline for d1lcea_: