Lineage for d5ihze_ (5ihz E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742339Domain d5ihze_: 5ihz E: [410177]
    Other proteins in same PDB: d5ihzb1, d5ihzb2, d5ihzd1, d5ihzd2, d5ihzf1, d5ihzf2, d5ihzl1, d5ihzl2
    automated match to d6shgh_

Details for d5ihze_

PDB Entry: 5ihz (more details), 1.64 Å

PDB Description: crystal structure of anti-gliadin 1002-1e01 fab fragment
PDB Compounds: (E:) 1E01 Fab fragment heavy chain

SCOPe Domain Sequences for d5ihze_:

Sequence, based on SEQRES records: (download)

>d5ihze_ b.1.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqllesggglvqpggslrlscaasgftfstyamswvrqapgkglewvsgisgsggstyya
dsvkgrfttsrdnskntlylqmnslraedtavyycakfsgkdcsgtscrdywgqgtlvtv
ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records): (download)

>d5ihze_ b.1.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqllesggglvqpggslrlscaasgftfstyamswvrqapgkglewvsgisgsggstyya
dsvkgrfttsrdnskntlylqmnslraedtavyycakfsgrdywgqgtlvtvssastkgp
svfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvp
ssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d5ihze_:

Click to download the PDB-style file with coordinates for d5ihze_.
(The format of our PDB-style files is described here.)

Timeline for d5ihze_:

  • d5ihze_ is new in SCOPe 2.08-stable