Lineage for d1vzaa_ (1vza A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. Protein Thymidylate synthase [55833] (7 species)
  7. Species Lactobacillus casei [TaxId:1582] [55835] (51 PDB entries)
  8. Domain d1vzaa_: 1vza A: [41017]
    complexed with ump; mutant

Details for d1vzaa_

PDB Entry: 1vza (more details), 2.5 Å

PDB Description: thymidylate synthase e60d mutant binary complex with 2'-deoxyuridine 5'-monophosphate (dump)
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1vzaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vzaa_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei [TaxId: 1582]}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfgliksd
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkapefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapvav

SCOPe Domain Coordinates for d1vzaa_ are not available.

Timeline for d1vzaa_: