Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Homo sapiens/mus [TaxId:1383439] [326989] (2 PDB entries) |
Domain d5i76b_: 5i76 B: [410165] Other proteins in same PDB: d5i76a2, d5i76c2 automated match to d6shgh_ |
PDB Entry: 5i76 (more details), 1.92 Å
SCOPe Domain Sequences for d5i76b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i76b_ b.1.1.0 (B:) automated matches {Homo sapiens/mus [TaxId: 1383439]} qvqlkqsgpglvqpsqslsitctvsgfsltnygvhwvrqspgkglewlgviwsggntdyn tpftsrlsinkdnsksqvffkmnslqsndtaiyycaraltyydyefaywgqgtlvtvsaa stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepks
Timeline for d5i76b_: